SCOPe 2.07: Domain d1vdhd_: 1vdh D:

Lineage for d1vdhd_ (1vdh D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.10: Chlorite dismutase-like [110965] (2 proteins)
   Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer

6. Protein Polyketide synthase CurD homologue TTHA1714/TTC1352 [110968] (1 species)

7. Species Thermus thermophilus [TaxId:274] [110969] (1 PDB entry)
   Uniprot Q5SHL6

8. Domain d1vdhd_: 1vdh D: [108526]
   Structural genomics target

Details for d1vdhd_

PDB Entry: 1vdh, 2 Å

PDB Description: Structure-based functional identification of a novel heme-binding protein from thermus thermophilus HB8

PDB Compounds: (D:) muconolactone isomerase-like protein

SCOPe Domain Sequences for d1vdhd_:

Sequence; same for both SEQRES and ATOM records:

>d1vdhd_ d.58.4.10 (D:) Polyketide synthase CurD homologue TTHA1714/TTC1352 {Thermus thermophilus [TaxId: 274]}
rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
lraflgl

Timeline for d1vdhd_:

• d1vdhd_ first appeared in SCOP 1.69
  
• d1vdhd_ appears in SCOPe 2.06
  
• d1vdhd_ appears in the current release, SCOPe 2.08