![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.10: Chlorite dismutase-like [110965] (2 proteins) Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer |
![]() | Protein Polyketide synthase CurD homologue TTHA1714/TTC1352 [110968] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [110969] (1 PDB entry) Uniprot Q5SHL6 |
![]() | Domain d1vdhd_: 1vdh D: [108526] Structural genomics target |
PDB Entry: 1vdh (more details), 2 Å
SCOPe Domain Sequences for d1vdhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vdhd_ d.58.4.10 (D:) Polyketide synthase CurD homologue TTHA1714/TTC1352 {Thermus thermophilus [TaxId: 274]} rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea lraflgl
Timeline for d1vdhd_:
![]() Domains from other chains: (mouse over for more information) d1vdha_, d1vdhb_, d1vdhc_, d1vdhe_ |