Lineage for d1vdhc_ (1vdh C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949878Family d.58.4.10: Chlorite dismutase-like [110965] (2 proteins)
    Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer
  6. 2949879Protein Polyketide synthase CurD homologue TTHA1714/TTC1352 [110968] (1 species)
  7. 2949880Species Thermus thermophilus [TaxId:274] [110969] (1 PDB entry)
    Uniprot Q5SHL6
  8. 2949883Domain d1vdhc_: 1vdh C: [108525]
    Structural genomics target

Details for d1vdhc_

PDB Entry: 1vdh (more details), 2 Å

PDB Description: Structure-based functional identification of a novel heme-binding protein from thermus thermophilus HB8
PDB Compounds: (C:) muconolactone isomerase-like protein

SCOPe Domain Sequences for d1vdhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdhc_ d.58.4.10 (C:) Polyketide synthase CurD homologue TTHA1714/TTC1352 {Thermus thermophilus [TaxId: 274]}
rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
lraflgl

SCOPe Domain Coordinates for d1vdhc_:

Click to download the PDB-style file with coordinates for d1vdhc_.
(The format of our PDB-style files is described here.)

Timeline for d1vdhc_: