Lineage for d1vdhb_ (1vdh B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504226Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (11 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 504322Family d.58.4.10: Chlorite dismutase-like (Pfam 06778) [110965] (2 proteins)
    duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer
  6. 504323Protein Polyketide synthase CurD homologue TTHA1714/TTC1352 [110968] (1 species)
  7. 504324Species Thermus thermophilus [TaxId:274] [110969] (1 PDB entry)
  8. 504326Domain d1vdhb_: 1vdh B: [108524]

Details for d1vdhb_

PDB Entry: 1vdh (more details), 2 Å

PDB Description: Structure-based functional identification of a novel heme-binding protein from thermus thermophilus HB8

SCOP Domain Sequences for d1vdhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdhb_ d.58.4.10 (B:) Polyketide synthase CurD homologue TTHA1714/TTC1352 {Thermus thermophilus}
rhvpepthtlegwhvlhdfrlldfarwfsaplearedaweelkglvrewreleeagqgsy
giyqvvghkadllflnlrpgldplleaearlsrsafarylgrsysfysvvelgsqekpld
pespyvkprltprvpksgyvcfypmnkrrqgqdnwymlpakeraslmkahgetgrkyqge
vmqvisgaqglddwewgvdlfsedpvqfkkivyemrfdevsarygefgpffvgkyldeea
lraflgl

SCOP Domain Coordinates for d1vdhb_:

Click to download the PDB-style file with coordinates for d1vdhb_.
(The format of our PDB-style files is described here.)

Timeline for d1vdhb_: