![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) ![]() contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.2.2: PB1 domain [64225] (8 proteins) Pfam 00564 forms heterodimers, although not all PB1 domain pairs associate. |
![]() | Protein Protein kinase C, iota type [110804] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110805] (2 PDB entries) |
![]() | Domain d1vd2a_: 1vd2 A: [108517] |
PDB Entry: 1vd2 (more details)
SCOP Domain Sequences for d1vd2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vd2a_ d.15.2.2 (A:) Protein kinase C, iota type {Human (Homo sapiens)} gplgsqvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpct vssqleleeafrlyelnkdsellihvfpc
Timeline for d1vd2a_: