Lineage for d1vd2a_ (1vd2 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499697Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 499713Family d.15.2.2: PB1 domain [64225] (5 proteins)
    Pfam 00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 499734Protein Protein kinase C, iota type [110804] (1 species)
  7. 499735Species Human (Homo sapiens) [TaxId:9606] [110805] (1 PDB entry)
  8. 499736Domain d1vd2a_: 1vd2 A: [108517]

Details for d1vd2a_

PDB Entry: 1vd2 (more details)

PDB Description: solution structure of the pb1 domain of pkciota

SCOP Domain Sequences for d1vd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vd2a_ d.15.2.2 (A:) Protein kinase C, iota type {Human (Homo sapiens)}
gplgsqvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpct
vssqleleeafrlyelnkdsellihvfpc

SCOP Domain Coordinates for d1vd2a_:

Click to download the PDB-style file with coordinates for d1vd2a_.
(The format of our PDB-style files is described here.)

Timeline for d1vd2a_: