Lineage for d1vd2a1 (1vd2 A:16-99)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933606Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2933622Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2933668Protein Protein kinase C, iota type [110804] (1 species)
  7. 2933669Species Human (Homo sapiens) [TaxId:9606] [110805] (2 PDB entries)
    Uniprot P41743 16-98 ! Uniprot P41743 16-99
  8. 2933671Domain d1vd2a1: 1vd2 A:16-99 [108517]
    Other proteins in same PDB: d1vd2a2

Details for d1vd2a1

PDB Entry: 1vd2 (more details)

PDB Description: solution structure of the pb1 domain of pkciota
PDB Compounds: (A:) Protein kinase C, iota type

SCOPe Domain Sequences for d1vd2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vd2a1 d.15.2.2 (A:16-99) Protein kinase C, iota type {Human (Homo sapiens) [TaxId: 9606]}
qvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpctvssql
eleeafrlyelnkdsellihvfpc

SCOPe Domain Coordinates for d1vd2a1:

Click to download the PDB-style file with coordinates for d1vd2a1.
(The format of our PDB-style files is described here.)

Timeline for d1vd2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vd2a2