Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
Protein Protein kinase C, iota type [110804] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110805] (2 PDB entries) Uniprot P41743 16-98 ! Uniprot P41743 16-99 |
Domain d1vd2a1: 1vd2 A:16-99 [108517] Other proteins in same PDB: d1vd2a2 |
PDB Entry: 1vd2 (more details)
SCOPe Domain Sequences for d1vd2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vd2a1 d.15.2.2 (A:16-99) Protein kinase C, iota type {Human (Homo sapiens) [TaxId: 9606]} qvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpctvssql eleeafrlyelnkdsellihvfpc
Timeline for d1vd2a1: