![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
![]() | Protein Rubredoxin [57804] (8 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries) Uniprot P24297 |
![]() | Domain d1vcxa_: 1vcx A: [108516] complexed with dod, fe |
PDB Entry: 1vcx (more details), 1.5 Å
SCOPe Domain Sequences for d1vcxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcxa_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]} akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled
Timeline for d1vcxa_: