![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein Stress sensor protease DegS, catalytic domain [110236] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110237] (12 PDB entries) Uniprot P31137 37-354 ! Uniprot P31137 |
![]() | Domain d1vcwa2: 1vcw A:43-254 [108511] Other proteins in same PDB: d1vcwa1, d1vcwa3, d1vcwb1, d1vcwb3, d1vcwc1, d1vcwc3 |
PDB Entry: 1vcw (more details), 3.05 Å
SCOPe Domain Sequences for d1vcwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcwa2 b.47.1.1 (A:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk sndgetpegigfaipfqlatkimdklirdgrv
Timeline for d1vcwa2: