Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein CTP synthase PyrG, N-terminal domain [110551] (3 species) |
Species Thermus thermophilus [TaxId:274] [110553] (3 PDB entries) Uniprot Q5SIA8 |
Domain d1vcoa2: 1vco A:11-282 [108509] Other proteins in same PDB: d1vcoa1 complexed with gln |
PDB Entry: 1vco (more details), 2.15 Å
SCOPe Domain Sequences for d1vcoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} prkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagtmrpyehgevf vtadgaetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsqtvqviphitd eikerirkvaeeqkaeivvvevggtvgdieslpfleairqfrfdegegntlylhltlvpy letseefktkptqhsvatlrgvgiqpdilvlrsarpvpeevrrkvalftnvrpghvfssp tvehlyevpllleeqglgraveralgleavip
Timeline for d1vcoa2: