Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
Protein CTP synthase PyrG, C-terminal domain [110481] (2 species) |
Species Thermus thermophilus [TaxId:274] [110483] (3 PDB entries) Uniprot Q5SIA8 |
Domain d1vcna1: 1vcn A:298-547 [108506] Other proteins in same PDB: d1vcna2 complexed with so4 |
PDB Entry: 1vcn (more details), 2.25 Å
SCOPe Domain Sequences for d1vcna1:
Sequence, based on SEQRES records: (download)
>d1vcna1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} ertvkiaiagkyvkmpdaylsllealrhagiknrarvevkwvdaesleaadldeafrdvs gilvpggfgvrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefd phtphpvidlmpeqleveglggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnp lyvdgleraglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfv gfveaalayq
>d1vcna1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} ertvkiaiagkpdaylsllealrhagiknrarvevkwvdaaadldeafrdvsgilvpggv rgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefdphtphpvidl mtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnplyvdgleraglvvsattpgmg aglveaielkdhpfflglqshpefksrpmrpsppfvgfveaalayq
Timeline for d1vcna1: