![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein CTP synthase PyrG, N-terminal domain [110551] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [110553] (3 PDB entries) Uniprot Q5SIA8 |
![]() | Domain d1vcma2: 1vcm A:11-282 [108505] Other proteins in same PDB: d1vcma1 |
PDB Entry: 1vcm (more details), 2.35 Å
SCOPe Domain Sequences for d1vcma2:
Sequence, based on SEQRES records: (download)
>d1vcma2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} prkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagtmrpyehgevf vtadgaetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsqtvqviphitd eikerirkvaeeqkaeivvvevggtvgdieslpfleairqfrfdegegntlylhltlvpy letseefktkptqhsvatlrgvgiqpdilvlrsarpvpeevrrkvalftnvrpghvfssp tvehlyevpllleeqglgraveralgleavip
>d1vcma2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} prkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagtmrpyehgevf vtadgaetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsqtvqviphitd eikerirkvaeeqkaeivvvevggtvgdieslpfleairqfrfdegegntlylhltlvpy lseefktkptqhsvatlrgvgiqpdilvlrsarpvpeevrrkvalftnvrpghvfssptv ehlyevpllleeqglgraveralgleavip
Timeline for d1vcma2: