Lineage for d1vcma1 (1vcm A:298-547)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104319Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 protein domains)
    contains a catalytic Cys-His-Glu triad
  6. 2104372Protein CTP synthase PyrG, C-terminal domain [110481] (2 species)
  7. 2104376Species Thermus thermophilus [TaxId:274] [110483] (3 PDB entries)
    Uniprot Q5SIA8
  8. 2104379Domain d1vcma1: 1vcm A:298-547 [108504]
    Other proteins in same PDB: d1vcma2

Details for d1vcma1

PDB Entry: 1vcm (more details), 2.35 Å

PDB Description: Crystal Structure of T.th. HB8 CTP synthetase
PDB Compounds: (A:) CTP synthetase

SCOPe Domain Sequences for d1vcma1:

Sequence, based on SEQRES records: (download)

>d1vcma1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ertvkiaiagkyvkmpdaylsllealrhagiknrarvevkwvdaesleaadldeafrdvs
gilvpggfgvrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefd
phtphpvidlmpeqleveglggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnp
lyvdgleraglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfv
gfveaalayq

Sequence, based on observed residues (ATOM records): (download)

>d1vcma1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ertvkiaiagkyvpdaylsllealrhagiknrarvevkwvdaesaadldeafrdvsgilv
pggfrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefdphtphp
vidlmpeqleveglggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnplyvdgl
eraglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfvgfveaa
layq

SCOPe Domain Coordinates for d1vcma1:

Click to download the PDB-style file with coordinates for d1vcma1.
(The format of our PDB-style files is described here.)

Timeline for d1vcma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vcma2