Lineage for d1vcla1 (1vcl A:1-150)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464433Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 464434Family b.42.2.1: Ricin B-like [50371] (6 proteins)
  6. 464447Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species)
  7. 464448Species Cucumaria echinata [TaxId:40245] [110212] (1 PDB entry)
  8. 464449Domain d1vcla1: 1vcl A:1-150 [108498]
    Other proteins in same PDB: d1vcla3, d1vclb3

Details for d1vcla1

PDB Entry: 1vcl (more details), 1.7 Å

PDB Description: crystal structure of hemolytic lectin cel-iii

SCOP Domain Sequences for d1vcla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata}
evlctnpldigelrsfkskqcvdivgnqgsgniatydcdglsdqqiiicgdgtirnearn
ycftpdgsgnanvmsspctlypeipssqrwrqgrrktftdnggieqvateiinlasgkcl
diegsdgtgdigvydcqnlddqyfyvrsrg

SCOP Domain Coordinates for d1vcla1:

Click to download the PDB-style file with coordinates for d1vcla1.
(The format of our PDB-style files is described here.)

Timeline for d1vcla1: