| Class b: All beta proteins [48724] (180 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
| Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species) |
| Species Cucumaria echinata [TaxId:40245] [110212] (4 PDB entries) Uniprot Q868M7 11-442 |
| Domain d1vcla1: 1vcl A:1-150 [108498] Other proteins in same PDB: d1vcla3, d1vclb3 complexed with btb, ca, cl, mg |
PDB Entry: 1vcl (more details), 1.7 Å
SCOPe Domain Sequences for d1vcla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]}
evlctnpldigelrsfkskqcvdivgnqgsgniatydcdglsdqqiiicgdgtirnearn
ycftpdgsgnanvmsspctlypeipssqrwrqgrrktftdnggieqvateiinlasgkcl
diegsdgtgdigvydcqnlddqyfyvrsrg
Timeline for d1vcla1: