Lineage for d1vc1b_ (1vc1 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577800Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 577820Superfamily c.13.2: Anti-sigma factor antagonist SpoIIaa [52091] (1 family) (S)
  5. 577821Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
  6. 577822Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)
  7. 577841Species Thermotoga maritima [TaxId:243274] [110449] (2 PDB entries)
  8. 577843Domain d1vc1b_: 1vc1 B: [108494]

Details for d1vc1b_

PDB Entry: 1vc1 (more details), 2 Å

PDB Description: Crystal structure of the TM1442 protein from Thermotoga maritima, a homolog of the Bacillus subtilis general stress response anti-anti-sigma factor RsbV

SCOP Domain Sequences for d1vc1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vc1b_ c.13.2.1 (B:) Anti-sigma factor antagonist SpoIIaa {Thermotoga maritima}
mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsa
glgtlvvilkdakingkefilsslkesisrilklthldkifkitdtveea

SCOP Domain Coordinates for d1vc1b_:

Click to download the PDB-style file with coordinates for d1vc1b_.
(The format of our PDB-style files is described here.)

Timeline for d1vc1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vc1a_