SCOPe 2.06: Domain d1vc1a_: 1vc1 A:

Lineage for d1vc1a_ (1vc1 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: SpoIIaa-like [52091] (2 families)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
   automatically mapped to Pfam PF01740

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [110449] (3 PDB entries)
   Uniprot Q9X1F5; TM1442

8. Domain d1vc1a_: 1vc1 A: [108493]

Details for d1vc1a_

PDB Entry: 1vc1, 2 Å

PDB Description: Crystal structure of the TM1442 protein from Thermotoga maritima, a homolog of the Bacillus subtilis general stress response anti-anti-sigma factor RsbV

PDB Compounds: (A:) Putative anti-sigma factor antagonist TM1442

SCOPe Domain Sequences for d1vc1a_:

Sequence; same for both SEQRES and ATOM records:

>d1vc1a_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Thermotoga maritima [TaxId: 2336]}
mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsa
glgtlvvilkdakingkefilsslkesisrilklthldkifkitdtveea

Timeline for d1vc1a_:

• d1vc1a_ first appeared in SCOP 1.69
  
• d1vc1a_ appears in SCOPe 2.05
  
• d1vc1a_ appears in SCOPe 2.07
  
• d1vc1a_ appears in the current release, SCOPe 2.08