SCOP 1.69: Domain d1vc1a_: 1vc1 A:

Lineage for d1vc1a_ (1vc1 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: Anti-sigma factor antagonist SpoIIaa [52091] (1 family)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Thermotoga maritima [TaxId:243274] [110449] (1 PDB entry)

8. Domain d1vc1a_: 1vc1 A: [108493]

Details for d1vc1a_

PDB Entry: 1vc1, 2 Å

PDB Description: Crystal structure of the TM1442 protein from Thermotoga maritima, a homolog of the Bacillus subtilis general stress response anti-anti-sigma factor RsbV

SCOP Domain Sequences for d1vc1a_:

Sequence; same for both SEQRES and ATOM records:

>d1vc1a_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Thermotoga maritima}
mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsa
glgtlvvilkdakingkefilsslkesisrilklthldkifkitdtveea

Timeline for d1vc1a_:

• d1vc1a_ is new in SCOP 1.69
  
• d1vc1a_ appears in SCOP 1.71
  
• d1vc1a_ appears in the current release, SCOPe 2.08