SCOP 1.71: Domain d1vc0a_: 1vc0 A:

Lineage for d1vc0a_ (1vc0 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (32 proteins)

6. Protein Splicesomal U1A protein [54932] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (24 PDB entries)

8. Domain d1vc0a_: 1vc0 A: [108492]
   complexed with sr; mutant

Details for d1vc0a_

PDB Entry: 1vc0, 2.5 Å

PDB Description: crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in imidazole and sr2+ solution

SCOP Domain Sequences for d1vc0a_:

Sequence; same for both SEQRES and ATOM records:

>d1vc0a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens)}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

Timeline for d1vc0a_:

• d1vc0a_ first appeared in SCOP 1.69
  
• d1vc0a_ appears in SCOP 1.73
  
• d1vc0a_ appears in the current release, SCOPe 2.08