Lineage for d1vbza_ (1vbz A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2559051Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 2559056Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. 2559107Domain d1vbza_: 1vbz A: [108491]
    protein/RNA complex; complexed with ba

Details for d1vbza_

PDB Entry: 1vbz (more details), 2.8 Å

PDB Description: crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in ba2+ solution
PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d1vbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbza_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

SCOPe Domain Coordinates for d1vbza_:

Click to download the PDB-style file with coordinates for d1vbza_.
(The format of our PDB-style files is described here.)

Timeline for d1vbza_: