Lineage for d1vbxa_ (1vbx A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. Domain d1vbxa_: 1vbx A: [108489]
    protein/RNA complex

Details for d1vbxa_

PDB Entry: 1vbx (more details), 2.7 Å

PDB Description: Crystal Structure of the Hepatitis Delta Virus Gemonic Ribozyme Precursor, with C75U mutaion, in EDTA solution
PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d1vbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbxa_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

SCOPe Domain Coordinates for d1vbxa_ are not available.

Timeline for d1vbxa_: