SCOP 1.71: Domain d1vbpb_: 1vbp B:

Lineage for d1vbpb_ (1vbp B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)

6. Protein Artocarpin [75022] (1 species)

7. Species Jackfruit (Artocarpus integrifolia) [75023] (5 PDB entries)

8. Domain d1vbpb_: 1vbp B: [108488]
   complexed with man, so4

Details for d1vbpb_

PDB Entry: 1vbp, 3.5 Å

PDB Description: crystal structure of artocarpin-mannopentose complex

SCOP Domain Sequences for d1vbpb_:

Sequence; same for both SEQRES and ATOM records:

>d1vbpb_ b.77.3.1 (B:) Artocarpin {Jackfruit (Artocarpus integrifolia)}
asqtitvgswggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

Timeline for d1vbpb_:

• d1vbpb_ first appeared in SCOP 1.69
  
• d1vbpb_ appears in SCOP 1.73
  
• d1vbpb_ appears in the current release, SCOPe 2.08