Class b: All beta proteins [48724] (149 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) |
Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins) |
Protein Artocarpin [75022] (1 species) |
Species Jackfruit (Artocarpus integrifolia) [75023] (5 PDB entries) |
Domain d1vbpb_: 1vbp B: [108488] complexed with man, so4 |
PDB Entry: 1vbp (more details), 3.5 Å
SCOP Domain Sequences for d1vbpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbpb_ b.77.3.1 (B:) Artocarpin {Jackfruit (Artocarpus integrifolia)} asqtitvgswggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf nlpienglivgfkgrtgdlldaigihmsl
Timeline for d1vbpb_: