Lineage for d1vbpb_ (1vbp B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. Protein Artocarpin [75022] (1 species)
  7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries)
    Uniprot Q7M1T4
  8. Domain d1vbpb_: 1vbp B: [108488]
    complexed with so4

Details for d1vbpb_

PDB Entry: 1vbp (more details), 3.5 Å

PDB Description: crystal structure of artocarpin-mannopentose complex
PDB Compounds: (B:) Artocarpin

SCOPe Domain Sequences for d1vbpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbpb_ b.77.3.1 (B:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
asqtitvgswggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

SCOPe Domain Coordinates for d1vbpb_ are not available.

Timeline for d1vbpb_:

Domains from other chains:
(mouse over for more information)
d1vbpa_