![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
![]() | Protein Artocarpin [75022] (1 species) |
![]() | Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries) Uniprot Q7M1T4 |
![]() | Domain d1vbpb_: 1vbp B: [108488] complexed with so4 |
PDB Entry: 1vbp (more details), 3.5 Å
SCOPe Domain Sequences for d1vbpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbpb_ b.77.3.1 (B:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]} asqtitvgswggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf nlpienglivgfkgrtgdlldaigihmsl
Timeline for d1vbpb_: