SCOPe 2.07: Domain d1vbpa_: 1vbp A:

Lineage for d1vbpa_ (1vbp A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Artocarpin [75022] (1 species)

7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries)
   Uniprot Q7M1T4

8. Domain d1vbpa_: 1vbp A: [108487]
   complexed with man, so4

Details for d1vbpa_

PDB Entry: 1vbp, 3.5 Å

PDB Description: crystal structure of artocarpin-mannopentose complex

PDB Compounds: (A:) Artocarpin

SCOPe Domain Sequences for d1vbpa_:

Sequence; same for both SEQRES and ATOM records:

>d1vbpa_ b.77.3.1 (A:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
asqtitvgswggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

Timeline for d1vbpa_:

• d1vbpa_ first appeared in SCOP 1.69
  
• d1vbpa_ appears in SCOPe 2.06
  
• d1vbpa_ appears in the current release, SCOPe 2.08