Class b: All beta proteins [48724] (176 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
Protein Artocarpin [75022] (1 species) |
Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries) Uniprot Q7M1T4 |
Domain d1vbpa_: 1vbp A: [108487] complexed with so4 |
PDB Entry: 1vbp (more details), 3.5 Å
SCOPe Domain Sequences for d1vbpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbpa_ b.77.3.1 (A:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]} asqtitvgswggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf nlpienglivgfkgrtgdlldaigihmsl
Timeline for d1vbpa_: