Lineage for d1vboh_ (1vbo H:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470062Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 470080Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 470081Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)
  6. 470082Protein Artocarpin [75022] (1 species)
  7. 470083Species Jackfruit (Artocarpus integrifolia) [75023] (5 PDB entries)
  8. 470091Domain d1vboh_: 1vbo H: [108486]

Details for d1vboh_

PDB Entry: 1vbo (more details), 2.35 Å

PDB Description: crystal structure of artocarpin-mannotriose complex

SCOP Domain Sequences for d1vboh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vboh_ b.77.3.1 (H:) Artocarpin {Jackfruit (Artocarpus integrifolia)}
asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

SCOP Domain Coordinates for d1vboh_:

Click to download the PDB-style file with coordinates for d1vboh_.
(The format of our PDB-style files is described here.)

Timeline for d1vboh_: