SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1vboh_ (1vbo H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068877Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2068917Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2068918Family b.77.3.1: Mannose-binding lectins [51102] (7 protein domains)
  6. 2068919Protein Artocarpin [75022] (1 species)
  7. 2068920Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries)
    Uniprot Q7M1T4
  8. 2068928Domain d1vboh_: 1vbo H: [108486]
    complexed with man

Details for d1vboh_

PDB Entry: 1vbo (more details), 2.35 Å

PDB Description: Crystal structure of artocarpin-mannotriose complex
PDB Compounds: (H:) Artocarpin

SCOPe Domain Sequences for d1vboh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vboh_ b.77.3.1 (H:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

SCOPe Domain Coordinates for d1vboh_:

Click to download the PDB-style file with coordinates for d1vboh_.
(The format of our PDB-style files is described here.)

Timeline for d1vboh_: