Lineage for d1vboe_ (1vbo E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068877Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2068917Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2068918Family b.77.3.1: Mannose-binding lectins [51102] (7 protein domains)
  6. 2068919Protein Artocarpin [75022] (1 species)
  7. 2068920Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries)
    Uniprot Q7M1T4
  8. 2068925Domain d1vboe_: 1vbo E: [108483]
    complexed with man

Details for d1vboe_

PDB Entry: 1vbo (more details), 2.35 Å

PDB Description: crystal structure of artocarpin-mannotriose complex
PDB Compounds: (E:) Artocarpin

SCOPe Domain Sequences for d1vboe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vboe_ b.77.3.1 (E:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

SCOPe Domain Coordinates for d1vboe_:

Click to download the PDB-style file with coordinates for d1vboe_.
(The format of our PDB-style files is described here.)

Timeline for d1vboe_: