![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) ![]() |
![]() | Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins) |
![]() | Protein Artocarpin [75022] (1 species) |
![]() | Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries) |
![]() | Domain d1vboc_: 1vbo C: [108481] |
PDB Entry: 1vbo (more details), 2.35 Å
SCOP Domain Sequences for d1vboc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vboc_ b.77.3.1 (C:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]} asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf nlpienglivgfkgrtgdlldaigihmsl
Timeline for d1vboc_: