Lineage for d1vbob_ (1vbo B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813155Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2813156Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2813157Protein Artocarpin [75022] (1 species)
  7. 2813158Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [75023] (5 PDB entries)
    Uniprot Q7M1T4
  8. 2813168Domain d1vbob_: 1vbo B: [108480]
    complexed with man

Details for d1vbob_

PDB Entry: 1vbo (more details), 2.35 Å

PDB Description: crystal structure of artocarpin-mannotriose complex
PDB Compounds: (B:) Artocarpin

SCOPe Domain Sequences for d1vbob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbob_ b.77.3.1 (B:) Artocarpin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
asqtitvgpwggpggngwddgsytgirqielsykeaigsfsviydlngdpfsgpkhtskl
pyknvkielkfpdeflesvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegtyf
nlpienglivgfkgrtgdlldaigihmsl

SCOPe Domain Coordinates for d1vbob_:

Click to download the PDB-style file with coordinates for d1vbob_.
(The format of our PDB-style files is described here.)

Timeline for d1vbob_: