Lineage for d1vbfc_ (1vbf C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490261Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 490262Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (39 families) (S)
  5. 490345Family c.66.1.7: Protein-L-isoaspartyl O-methyltransferase [53354] (1 protein)
    topological variant; strand order 3214567; strand 6 is antiparallel to the rest
  6. 490346Protein Protein-L-isoaspartyl O-methyltransferase [68927] (5 species)
  7. 490358Species Sulfolobus tokodaii [TaxId:111955] [110668] (1 PDB entry)
  8. 490361Domain d1vbfc_: 1vbf C: [108477]

Details for d1vbfc_

PDB Entry: 1vbf (more details), 2.8 Å

PDB Description: Crystal structure of protein L-isoaspartate O-methyltransferase homologue from Sulfolobus tokodaii

SCOP Domain Sequences for d1vbfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbfc_ c.66.1.7 (C:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii}
asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
nspslenlgevmfgrigglygfyddyddiefrvnklerqiksil

SCOP Domain Coordinates for d1vbfc_:

Click to download the PDB-style file with coordinates for d1vbfc_.
(The format of our PDB-style files is described here.)

Timeline for d1vbfc_: