Lineage for d1vavb_ (1vav B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460700Family b.29.1.18: Alginate lyase [101649] (3 proteins)
    members have same function and similar structures but low sequence similarity
  6. 460704Protein Alginate lyase PA1167 [110138] (1 species)
  7. 460705Species Pseudomonas aeruginosa [TaxId:287] [110139] (1 PDB entry)
  8. 460707Domain d1vavb_: 1vav B: [108473]
    Structural genomics target

Details for d1vavb_

PDB Entry: 1vav (more details), 2 Å

PDB Description: Crystal structure of alginate lyase PA1167 from Pseudomonas aeruginosa at 2.0 A resolution

SCOP Domain Sequences for d1vavb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vavb_ b.29.1.18 (B:) Alginate lyase PA1167 {Pseudomonas aeruginosa}
pdlstwnltipqgrpaitistsqlqrdyrsdyfqrtadgirfwvpvngshtrnsefprse
lretlssgrpynwryaradnwleatlrieavpstrrmiigqihsdgsnsgqaaplvklly
qlrldqgrvqalvrerpddggtraytlmdgiplgqpfsyrigvsrsgllsvsvngsaleq
qldpqwayqglyfkaglylqdnrgpsseggratfselrvshq

SCOP Domain Coordinates for d1vavb_:

Click to download the PDB-style file with coordinates for d1vavb_.
(The format of our PDB-style files is described here.)

Timeline for d1vavb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vava_