Lineage for d1vavb_ (1vav B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780467Family b.29.1.18: Alginate lyase [101649] (3 proteins)
    members have same function and similar structures but low sequence similarity
    automatically mapped to Pfam PF08787
  6. 2780471Protein Alginate lyase PA1167 [110138] (1 species)
  7. 2780472Species Pseudomonas aeruginosa [TaxId:287] [110139] (1 PDB entry)
    Uniprot Q9I4H0
  8. 2780474Domain d1vavb_: 1vav B: [108473]
    Structural genomics target

Details for d1vavb_

PDB Entry: 1vav (more details), 2 Å

PDB Description: Crystal structure of alginate lyase PA1167 from Pseudomonas aeruginosa at 2.0 A resolution
PDB Compounds: (B:) Alginate lyase PA1167

SCOPe Domain Sequences for d1vavb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vavb_ b.29.1.18 (B:) Alginate lyase PA1167 {Pseudomonas aeruginosa [TaxId: 287]}
pdlstwnltipqgrpaitistsqlqrdyrsdyfqrtadgirfwvpvngshtrnsefprse
lretlssgrpynwryaradnwleatlrieavpstrrmiigqihsdgsnsgqaaplvklly
qlrldqgrvqalvrerpddggtraytlmdgiplgqpfsyrigvsrsgllsvsvngsaleq
qldpqwayqglyfkaglylqdnrgpsseggratfselrvshq

SCOPe Domain Coordinates for d1vavb_:

Click to download the PDB-style file with coordinates for d1vavb_.
(The format of our PDB-style files is described here.)

Timeline for d1vavb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vava_