Lineage for d1vaib_ (1vai B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565060Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 565061Superfamily b.62.1: Cyclophilin-like [50891] (2 families) (S)
  5. 565062Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 565204Protein Peptidyl-prolyl cis-trans isomerase A, PpiA [50901] (2 species)
  7. 565205Species Escherichia coli [TaxId:562] [50902] (6 PDB entries)
  8. 565211Domain d1vaib_: 1vai B: [108471]
    complexed with ace, mcm; mutant

Details for d1vaib_

PDB Entry: 1vai (more details), 1.8 Å

PDB Description: structure of e. coli cyclophilin b k163t mutant bound to n-acetyl-ala- ala-pro-ala-7-amino-4-methylcoumarin

SCOP Domain Sequences for d1vaib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vaib_ b.62.1.1 (B:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli}
akgdphvllttsagnieleldkqkapvsvqnfvdyvnsgfynnttfhrvipgfmiqgggf
teqmqqkkpnppikneadnglrntrgtiamartadkdsatsqffinvadnafldhgqrdf
gyavfgkvvkgmdvadkisqvpthdvgpyqnvpskpvvilsatvlp

SCOP Domain Coordinates for d1vaib_:

Click to download the PDB-style file with coordinates for d1vaib_.
(The format of our PDB-style files is described here.)

Timeline for d1vaib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vaia_