| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) ![]() |
| Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein) |
| Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [82821] (33 PDB entries) Uniprot P29476 298-716 |
| Domain d1vaga_: 1vag A: [108469] complexed with arr, h4b, hem, zn |
| PDB Entry: 1vag (more details) PDB Description: neuronal nitric oxide synthase oxygenase domain complexed wi inhibitor ar-r17477
PDB Compounds: (A:) Nitric-oxide synthase, brainSCOP Domain Sequences for d1vaga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vaga_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
gprflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfp
lakefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcv
griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
sqliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqi
ppelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
dycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
SCOP Domain Coordinates for d1vaga_:
Click to download the PDB-style file with coordinates for d1vaga_. (The format of our PDB-style files is described here.)
Timeline for d1vaga_:
d1vaga_ appears in SCOP 1.73 | d1vaga_ (click for larger image) d1vaga_ in context of chain |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |