SCOPe 2.08: Domain d1vaga1: 1vag A:298-716

Lineage for d1vaga1 (1vag A:298-716)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [82821] (277 PDB entries)
   Uniprot P29476 298-716

8. Domain d1vaga1: 1vag A:298-716 [108469]
   Other proteins in same PDB: d1vaga2
   complexed with arr, h4b, hem, zn

Details for d1vaga1

PDB Entry: 1vag, 2 Å

PDB Description: neuronal nitric oxide synthase oxygenase domain complexed with the inhibitor ar-r17477

PDB Compounds: (A:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d1vaga1:

Sequence; same for both SEQRES and ATOM records:

>d1vaga1 d.174.1.1 (A:298-716) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
prflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpl
akefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvg
riqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwns
qliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqip
pelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrd
ycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsates
fikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Timeline for d1vaga1:

• d1vaga1 first appeared in SCOP 1.69, called d1vaga_
  
• d1vaga1 appears in SCOPe 2.07