SCOPe 2.04: Domain d1vafb_: 1vaf B:

Lineage for d1vafb_ (1vaf B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
   Uniprot P29477 77-496 ! Uniprot P29477 77-495

8. Domain d1vafb_: 1vaf B: [108468]
   complexed with arr, h4b, hem, zn

Details for d1vafb_

PDB Entry: 1vaf, 2.9 Å

PDB Description: inducible nitric oxide synthase oxygenase domain complexed with the inhibitor ar-r17477

PDB Compounds: (B:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d1vafb_:

Sequence; same for both SEQRES and ATOM records:

>d1vafb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiw

Timeline for d1vafb_:

• d1vafb_ first appeared in SCOP 1.69
  
• d1vafb_ appears in SCOPe 2.03
  
• d1vafb_ appears in SCOPe 2.05
  
• d1vafb_ appears in the current release, SCOPe 2.08