Lineage for d1vafa_ (1vaf A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941879Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1941880Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1941881Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1941882Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1942088Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 1942153Domain d1vafa_: 1vaf A: [108467]
    complexed with arr, h4b, hem, zn

Details for d1vafa_

PDB Entry: 1vaf (more details), 2.9 Å

PDB Description: inducible nitric oxide synthase oxygenase domain complexed with the inhibitor ar-r17477
PDB Compounds: (A:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d1vafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vafa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiw

SCOPe Domain Coordinates for d1vafa_:

Click to download the PDB-style file with coordinates for d1vafa_.
(The format of our PDB-style files is described here.)

Timeline for d1vafa_: