Lineage for d1vafa_ (1vaf A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514921Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 514922Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 514923Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 514924Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 515026Species Mouse (Mus musculus) [TaxId:10090] [56515] (23 PDB entries)
  8. 515063Domain d1vafa_: 1vaf A: [108467]

Details for d1vafa_

PDB Entry: 1vaf (more details), 2.9 Å

PDB Description: inducible nitric oxide synthase oxygenase domain complexed with the inhibitor ar-r17477

SCOP Domain Sequences for d1vafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vafa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus)}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiw

SCOP Domain Coordinates for d1vafa_:

Click to download the PDB-style file with coordinates for d1vafa_.
(The format of our PDB-style files is described here.)

Timeline for d1vafa_: