Lineage for d1vaea_ (1vae A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462260Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 462261Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 462262Family b.36.1.1: PDZ domain [50157] (29 proteins)
    Pfam 00595
  6. 462353Protein Rhophilin-2 [110184] (1 species)
  7. 462354Species Mouse (Mus musculus) [TaxId:10090] [110185] (1 PDB entry)
  8. 462355Domain d1vaea_: 1vae A: [108466]
    Structural genomics target

Details for d1vaea_

PDB Entry: 1vae (more details)

PDB Description: solution structure of the pdz domain of mouse rhophilin-2

SCOP Domain Sequences for d1vaea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus)}
gssgssgsaskrwspprgihftveegdlgftlrgntpvqvhfldphcsaslagakegdyi
vsiqgvdckwltvsevmkllksfggeevemkvvslldstssmhnksgpssg

SCOP Domain Coordinates for d1vaea_:

Click to download the PDB-style file with coordinates for d1vaea_.
(The format of our PDB-style files is described here.)

Timeline for d1vaea_: