Lineage for d1vaea1 (1vae A:8-105)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786062Protein Rhophilin-2 [110184] (1 species)
  7. 2786063Species Mouse (Mus musculus) [TaxId:10090] [110185] (1 PDB entry)
    Uniprot Q8BWR8 506-603
  8. 2786064Domain d1vaea1: 1vae A:8-105 [108466]
    Other proteins in same PDB: d1vaea2, d1vaea3
    Structural genomics target

Details for d1vaea1

PDB Entry: 1vae (more details)

PDB Description: solution structure of the pdz domain of mouse rhophilin-2
PDB Compounds: (A:) rhophilin, Rho GTPase binding protein 2

SCOPe Domain Sequences for d1vaea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vaea1 b.36.1.1 (A:8-105) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]}
saskrwspprgihftveegdlgftlrgntpvqvhfldphcsaslagakegdyivsiqgvd
ckwltvsevmkllksfggeevemkvvslldstssmhnk

SCOPe Domain Coordinates for d1vaea1:

Click to download the PDB-style file with coordinates for d1vaea1.
(The format of our PDB-style files is described here.)

Timeline for d1vaea1: