Lineage for d1va5b_ (1va5 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1002939Family c.69.1.3: Mycobacterial antigens [53491] (4 proteins)
  6. 1002949Protein Antigen 85c [53494] (1 species)
  7. 1002950Species Mycobacterium tuberculosis [TaxId:1773] [53495] (3 PDB entries)
    Uniprot P31953
  8. 1002955Domain d1va5b_: 1va5 B: [108465]
    complexed with sog

Details for d1va5b_

PDB Entry: 1va5 (more details), 2.02 Å

PDB Description: antigen 85c with octylthioglucoside in active site
PDB Compounds: (B:) Antigen 85-C

SCOPe Domain Sequences for d1va5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1va5b_ c.69.1.3 (B:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}
mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng

SCOPe Domain Coordinates for d1va5b_:

Click to download the PDB-style file with coordinates for d1va5b_.
(The format of our PDB-style files is described here.)

Timeline for d1va5b_: