Lineage for d1v9yb_ (1v9y B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922630Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1922707Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)
  6. 1922708Protein Direct oxygen sensor protein, DOS [111118] (1 species)
    Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU
  7. 1922709Species Escherichia coli [TaxId:562] [111119] (5 PDB entries)
    Uniprot P76129 8-126 ! Uniprot P76129 12-124
  8. 1922711Domain d1v9yb_: 1v9y B: [108455]
    complexed with hem

Details for d1v9yb_

PDB Entry: 1v9y (more details), 1.32 Å

PDB Description: Crystal Structure of the heme PAS sensor domain of Ec DOS (ferric form)
PDB Compounds: (B:) Heme pas sensor protein

SCOPe Domain Sequences for d1v9yb_:

Sequence, based on SEQRES records: (download)

>d1v9yb_ d.110.3.2 (B:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrd

Sequence, based on observed residues (ATOM records): (download)

>d1v9yb_ d.110.3.2 (B:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnrerelqlekkdgskiwtrfalskvsaegkvyylalvrd

SCOPe Domain Coordinates for d1v9yb_:

Click to download the PDB-style file with coordinates for d1v9yb_.
(The format of our PDB-style files is described here.)

Timeline for d1v9yb_: