![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins) |
![]() | Protein Direct oxygen sensor protein, DOS [111118] (1 species) Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU |
![]() | Species Escherichia coli [TaxId:562] [111119] (5 PDB entries) Uniprot P76129 8-126 Uniprot P76129 12-124 Uniprot P76129 8-126 ! Uniprot P76129 12-124 |
![]() | Domain d1v9ya_: 1v9y A: [108454] |
PDB Entry: 1v9y (more details), 1.32 Å
SCOP Domain Sequences for d1v9ya_:
Sequence, based on SEQRES records: (download)
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrd
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe yirhnrerelqlekkdgskiwtrfalskvsaegkvyylalvrd
Timeline for d1v9ya_: