Lineage for d1v9ya_ (1v9y A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609436Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 609514Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 609552Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins)
  6. 609553Protein Direct oxygen sensor protein, DOS [111118] (1 species)
    Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddU
  7. 609554Species Escherichia coli [TaxId:562] [111119] (4 PDB entries)
  8. 609555Domain d1v9ya_: 1v9y A: [108454]

Details for d1v9ya_

PDB Entry: 1v9y (more details), 1.32 Å

PDB Description: Crystal Structure of the heme PAS sensor domain of Ec DOS (ferric form)

SCOP Domain Sequences for d1v9ya_:

Sequence, based on SEQRES records: (download)

>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrd

Sequence, based on observed residues (ATOM records): (download)

>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnrerelqlekkdgskiwtrfalskvsaegkvyylalvrd

SCOP Domain Coordinates for d1v9ya_:

Click to download the PDB-style file with coordinates for d1v9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1v9ya_: