SCOPe 2.06: Domain d1v9wa1: 1v9w A:8-130

Lineage for d1v9wa1 (1v9w A:8-130)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.16: Txnl5-like [110612] (1 protein)
   Pfam PF06110

6. Protein Putative 42-9-9 protein (thioredoxin containing protein Txnl5) [110613] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110614] (1 PDB entry)
   Uniprot Q9D0Y4

8. Domain d1v9wa1: 1v9w A:8-130 [108453]
   Other proteins in same PDB: d1v9wa2
   Structural genomics target

Details for d1v9wa1

PDB Entry: 1v9w

PDB Description: solution structure of mouse putative 42-9-9 protein

PDB Compounds: (A:) putative 42-9-9 protein

SCOPe Domain Sequences for d1v9wa1:

Sequence; same for both SEQRES and ATOM records:

>d1v9wa1 c.47.1.16 (A:8-130) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Mouse (Mus musculus) [TaxId: 10090]}
matfeevsvlgfeefdkavkehesktifayfsgskdtegkswcpdcveaepvireglkhv
tedcvfiycqvgdkpywkdpnndfrqklkitavptllkygtpqklveseccqsslvemif
sed

Timeline for d1v9wa1:

• d1v9wa1 first appeared in SCOP 1.69, called d1v9wa_
  
• d1v9wa1 was called d1v9wa_ in SCOPe 2.05
  
• d1v9wa1 appears in SCOPe 2.07
  
• d1v9wa1 appears in the current release, SCOPe 2.08