Lineage for d1v9tb_ (1v9t B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468514Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 468515Superfamily b.62.1: Cyclophilin-like [50891] (2 families) (S)
  5. 468516Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 468517Protein Bacterial cyclophilin [50901] (1 species)
  7. 468518Species Escherichia coli [TaxId:562] [50902] (6 PDB entries)
  8. 468520Domain d1v9tb_: 1v9t B: [108452]

Details for d1v9tb_

PDB Entry: 1v9t (more details), 1.7 Å

PDB Description: structure of e. coli cyclophilin b k163t mutant bound to succinyl-ala-pro-ala-p-nitroanilide

SCOP Domain Sequences for d1v9tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9tb_ b.62.1.1 (B:) Bacterial cyclophilin {Escherichia coli}
akgdphvllttsagnieleldkqkapvsvqnfvdyvnsgfynnttfhrvipgfmiqgggf
teqmqqkkpnppikneadnglrntrgtiamartadkdsatsqffinvadnafldhgqrdf
gyavfgkvvkgmdvadkisqvpthdvgpyqnvpskpvvilsatvlp

SCOP Domain Coordinates for d1v9tb_:

Click to download the PDB-style file with coordinates for d1v9tb_.
(The format of our PDB-style files is described here.)

Timeline for d1v9tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v9ta_