SCOPe 2.05: Domain d1v9fa_: 1v9f A:

Lineage for d1v9fa_ (1v9f A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
   contains N-terminal alpha-L RNA-binding motif

6. Protein Ribosomal large subunit pseudouridine synthase D, RluD [103019] (1 species)

7. Species Escherichia coli [TaxId:562] [103020] (3 PDB entries)
   Uniprot P33643

8. Domain d1v9fa_: 1v9f A: [108448]
   complexed with po4

Details for d1v9fa_

PDB Entry: 1v9f, 1.7 Å

PDB Description: Crystal structure of catalytic domain of pseudouridine synthase RluD from Escherichia coli

PDB Compounds: (A:) Ribosomal large subunit pseudouridine synthase D

SCOPe Domain Sequences for d1v9fa_:

Sequence; same for both SEQRES and ATOM records:

>d1v9fa_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase D, RluD {Escherichia coli [TaxId: 562]}
fepqdipldivyedediiiinkprdlvvhpgagnpdgtvlnallhyyppiadvpragivh
rldkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhptkr
thmavhpmgkpavthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyggr
prppkgaseafistlrkfdrqalhatmlrlyhpisgiemewhapipqdmvelievmradf
eehkdevdwl

Timeline for d1v9fa_:

• d1v9fa_ first appeared in SCOP 1.69
  
• d1v9fa_ appears in SCOPe 2.04
  
• d1v9fa_ appears in SCOPe 2.06
  
• d1v9fa_ appears in the current release, SCOPe 2.08