Lineage for d1v97b6 (1v97 B:192-414)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875230Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 875231Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) (S)
  5. 875301Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (5 proteins)
  6. 875341Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 875342Species Cow (Bos taurus) [TaxId:9913] [56192] (6 PDB entries)
    Uniprot P80457
  8. 875344Domain d1v97b6: 1v97 B:192-414 [108447]
    Other proteins in same PDB: d1v97a1, d1v97a2, d1v97a3, d1v97a4, d1v97a5, d1v97b1, d1v97b2, d1v97b3, d1v97b4, d1v97b5
    complexed with acy, ca, fad, fes, fyx, gol, mos, mte

Details for d1v97b6

PDB Entry: 1v97 (more details), 1.94 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase FYX-051 bound form
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOP Domain Sequences for d1v97b6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v97b6 d.145.1.3 (B:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOP Domain Coordinates for d1v97b6:

Click to download the PDB-style file with coordinates for d1v97b6.
(The format of our PDB-style files is described here.)

Timeline for d1v97b6: