Lineage for d1v97b4 (1v97 B:415-528)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728691Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 728832Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 728833Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 728873Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 728874Species Cow (Bos taurus) [TaxId:9913] [55453] (5 PDB entries)
  8. 728876Domain d1v97b4: 1v97 B:415-528 [108445]
    Other proteins in same PDB: d1v97a1, d1v97a2, d1v97a3, d1v97a5, d1v97a6, d1v97b1, d1v97b2, d1v97b3, d1v97b5, d1v97b6
    complexed with acy, ca, fad, fes, fyx, gol, mos, mte

Details for d1v97b4

PDB Entry: 1v97 (more details), 1.94 Å

PDB Description: Crystal Structure of Bovine Milk Xanthine Dehydrogenase FYX-051 bound form
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOP Domain Sequences for d1v97b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v97b4 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOP Domain Coordinates for d1v97b4:

Click to download the PDB-style file with coordinates for d1v97b4.
(The format of our PDB-style files is described here.)

Timeline for d1v97b4: